제품 > 항체 > 단일클론항체(mAb)

4-1BB/CD137 Rabbit mAb (A22167)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from wild type (WT) and 293T cells transfected with 4-1BB/CD137 using 4-1BB/CD137 Rabbit mAb (A22167) at1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Overview

Product name	4-1BB/CD137 Rabbit mAb
Catalog No.	A22167
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC55368

Background

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contributes to the clonal expansion, survival, and development of T cells. It can also induce proliferation in peripheral monocytes, enhance T cell apoptosis induced by TCR/CD3 triggered activation, and regulate CD28 co-stimulation to promote Th1 cell responses. The expression of this receptor is induced by lymphocyte activation. TRAF adaptor proteins have been shown to bind to this receptor and transduce the signals leading to activation of NF-kappaB.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 24-186 of human 4-1BB/CD137 (NP_001552.2).
Sequence	LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ
Gene ID
Swiss Prot
Synonyms	ILA; 4-1BB; CD137; CDw137; IMD109; 4-1BB/CD137
Calculated MW	28kDa
Observed MW	24-28kDa 40-50kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:20000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	293T transfected with 4-1BB/CD137
Cellular location	Membrane, Single-pass type I membrane protein