제품 > 항체 > 단일클론항체(mAb)

ABflo® 488 Rabbit anti-Mouse CD126/IL-6Rα chain mAb (A25149)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 C2C12 cells (Low Expression, left) and RAW 264.7 cells (right) were surface-stained with ABflo® 488 Rabbit anti-Mouse CD126/IL-6Rα chain mAb (A25149, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 RAW 264.7 cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Mouse CD126/IL-6Rα chain mAb (A25149, 5 μl/Test, right).

Overview

Product name	ABflo® 488 Rabbit anti-Mouse CD126/IL-6Rα chain mAb
Catalog No.	A25149
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC63756-ABflo488

Background

Enables interleukin-6 binding activity and interleukin-6 receptor activity. Involved in T-helper 17 cell lineage commitment and interleukin-6-mediated signaling pathway. Located in cell surface. Part of interleukin-6 receptor complex. Is expressed in several structures, including adipose tissue; alimentary system; genitourinary system; hemolymphoid system; and nervous system. Human ortholog(s) of this gene implicated in Alzheimer's disease; Huntington's disease; hyper IgE syndrome; obesity; and stomach cancer. Orthologous to human IL6R (interleukin 6 receptor).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 20-357 of mouse CD126/IL-6Rα chain (NP_034689.2).
Sequence	LVLGSCRALEVANGTVTSLPGATVTLICPGKEAAGNVTIHWVYSGSQNREWTTTGNTLVLRDVQLSDTGDYLCSLNDHLVGTVPLLVDVPPEEPKLSCFRKNPLVNAICEWRPSSTPSPTTKAVLFAKKINTTNGKSDFQVPCQYSQQLKSFSCQVEILEGDKVYHIVSLCVANSVGSKSSHNEAFHSLKMVQPDPPANLVVSAIPGRPRWLKVSWQHPETWDPSYYLLQFQLRYRPVWSKEFTVLLLPVAQYQCVIHDALRGVKHVVQVRGKEELDLGQWSEWSPEVTGTPWIAEPRTTPAGILWNPTQVSVEDSANHEDQYESSTEATSVLAPVQE
Gene ID
Swiss Prot
Synonyms	Il6r; CD126; IL-6R; IL-6RA; IL-6R-alpha
Calculated MW	50kDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, single-pass type I membrane protein, secreted