제품 > 항체 > 단일클론항체(mAb)

ABflo® 594 Rabbit anti-Mouse CD124/IL-4Ra mAb (A24725)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 293F cells (negative control, left) and 293F (Transfection, right) cells were surface-stained with ABflo® 594 Rabbit anti-Mouse CD124/IL-4Ra mAb (A24725, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 293F (Transfection) cells were surface-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or ABflo® 594 Rabbit anti-Mouse CD124/IL-4Ra mAb (A24725, 5 μl/Test, right).

Overview

Product name	ABflo® 594 Rabbit anti-Mouse CD124/IL-4Ra mAb
Catalog No.	A24725
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC64063-ABflo594

Background

Predicted to enable cytokine receptor activity. Involved in positive regulation of chemokine production; positive regulation of cold-induced thermogenesis; and positive regulation of macrophage activation. Acts upstream of or within several processes, including defense response to protozoan; negative regulation of T-helper 1 cell differentiation; and positive regulation of immune effector process. Predicted to be located in several cellular components, including centriolar satellite; extracellular space; and nucleoplasm. Predicted to be part of receptor complex. Is expressed in several structures, including adrenal medulla; early conceptus; hemolymphoid system; medulla oblongata basal plate mantle layer; and reproductive system. Used to study asthma. Human ortholog(s) of this gene implicated in several diseases, including acne; allergic conjunctivitis; autoimmune disease (multiple); human immunodeficiency virus infectious disease; and renal tuberculosis. Orthologous to human IL4R (interleukin 4 receptor).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 26-233 of mouse CD124/IL-4Ra (NP_001008700.1).
Sequence	IKVLGEPTCFSDYIRTSTCEWFLDSAVDCSSQLCLHYRLMFFEFSENLTCIPRNSASTVCVCHMEMNRPVQSDRYQMELWAEHRQLWQGSFSPSGNVKPLAPDNLTLHTNVSDEWLLTWNNLYPSNNLLYKDLISMVNISREDNPAEFIVYNVTYKEPRLSFPINILMSGVYYTARVRVRSQILTGTWSEWSPSITWYNHFQLPLIQR
Gene ID
Swiss Prot
Synonyms	Il4r; CD124
Calculated MW	87kDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane ; Single-pass type I membrane protein