제품 > 항체 > 단일클론항체(mAb)

ABflo® 594 Rabbit anti-Mouse Ly-6A/E (Sca-1) mAb (A24400)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry:1X10^6 Raw 264.7 cells (negative control, left) and C57BL/6 mouse Splenocytes cells (right) were surface-stained with ABflo® 594 Rabbit anti-Mouse Ly-6A/E (Sca-1) mAb(A24400, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Overview

Product name	ABflo® 594 Rabbit anti-Mouse Ly-6A/E (Sca-1) mAb
Catalog No.	A24400
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC57786-ABflo594

Background

T-cell activation.Predicted to enable acetylcholine receptor binding activity and acetylcholine receptor inhibitor activity. Acts upstream of or within response to bacterium. Located in external side of plasma membrane. Is expressed in alimentary system; hindlimb tendon; liver; metanephros; and physiological umbilical hernia. Used to study osteoporosis. Orthologous to human LY6H (lymphocyte antigen 6 family member H).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 27-111 of mouse Ly-6A/E (Sca-1)(NP_034868.1).
Sequence	LECYQCYGVPFETSCPSITCPYPDGVCVTQEAAVIVDSQTRKVKNNLCLPICPPNIESMEILGTKVNVKTSCCQEDLCNVAVPNG
Gene ID
Swiss Prot
Synonyms	Ly-6A.2; Ly-6A/E; Ly-6E.1; Sca-1; Sca1; TAP
Calculated MW	114kDa
Observed MW	Refer to figures

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	external side of plasma membrane, plasma membrane