제품 > 항체 > 다중클론항체(pAb)

AKT2 Rabbit pAb (A0336)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of extracts of various cell lines, using AKT2 antibody (A0336).
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

ABclonal:Immunofluorescence - AKT2 Rabbit pAb (A0336)

Immunofluorescence analysis of HeLa cells using AKT2 antibody (A0336) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	AKT2 Rabbit pAb
Catalog No.	A0336
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene is a putative oncogene encoding a protein belonging to a subfamily of serine/threonine kinases containing SH2-like (Src homology 2-like) domains, which is involved in signaling pathways. The gene serves as an oncogene in the tumorigenesis of cancer cells For example, its overexpression contributes to the malignant phenotype of a subset of human ductal pancreatic cancers. The encoded protein is a general protein kinase capable of phophorylating several known proteins, and has also been implicated in insulin signaling.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 400-500 of human AKT2 (NP_001617.1).
Sequence	AKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIRE
Gene ID
Swiss Prot
Synonyms	PKBB; PRKBB; HIHGHH; PKBBETA; RAC-BETA
Calculated MW	56kDa
Observed MW	65kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, NIH/3T3
Cellular location	Cell membrane, Cytoplasm, Early endosome, Nucleus, Peripheral membrane protein
Customer validation	WB(Homo sapiens, Mus musculus) IHC(Mus musculus)