제품 > 항체 > 단일클론항체(mAb)

ALDH1A1 Rabbit mAb (A0157)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using ALDH1A1 Rabbit mAb (A0157) at 1:20000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - ALDH1A1 Rabbit mAb (A0157)

Immunofluorescence analysis of A549 using ALDH1A1 Rabbit mAb (A0157) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of Hep G2 using ALDH1A1 Rabbit mAb (A0157) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - ALDH1A1 Rabbit mAb (A0157)

Immunoprecipitation analysis of 300 μg extracts of A-549 cells using 3 μg ALDH1A1 Rabbit mAb antibody (A0157). Western blot was performed from the immunoprecipitate using ALDH1A1 Rabbit mAb (A0157) at a dilition of 1:20000.

Overview

Product name	ALDH1A1 Rabbit mAb
Catalog No.	A0157
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC52440

Background

The protein encoded by this gene belongs to the aldehyde dehydrogenase family. Aldehyde dehydrogenase is the next enzyme after alcohol dehydrogenase in the major pathway of alcohol metabolism. There are two major aldehyde dehydrogenase isozymes in the liver, cytosolic and mitochondrial, which are encoded by distinct genes, and can be distinguished by their electrophoretic mobility, kinetic properties, and subcellular localization. This gene encodes the cytosolic isozyme. Studies in mice show that through its role in retinol metabolism, this gene may also be involved in the regulation of the metabolic responses to high-fat diet.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 250-350 of human ALDH1A1 (NP_000680.2).
Sequence	VGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQ
Gene ID
Swiss Prot
Synonyms	ALDC; ALDH1; HEL-9; HEL12; PUMB1; ALDH11; RALDH1; ALDH-E1; HEL-S-53e; ALDH1A1
Calculated MW	55kDa
Observed MW	55kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:50000 - 1:200000 IF/ICC 1:100 - 1:800 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	A549, Hep G2, Mouse lung, Mouse liver, Mouse testis, Rat lung, Rat kidney, Rat testis
Cellular location	Cytoplasm.
Customer validation	IF(Homo sapiens) WB(Homo sapiens, Mus musculus) PCR(Other)