제품 > 항체 > 다중클론항체(pAb)

ALDH7A1 Rabbit pAb (A8629)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using ALDH7A1 Rabbit pAb (A8629) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Negative control (NC): K-562.
Exposure time: 75s.

ABclonal:Immunohistochemistry - ALDH7A1 Rabbit pAb (A8629)

Immunohistochemistry analysis of ALDH7A1 in paraffin-embedded human kidney tissue using ALDH7A1 Rabbit pAb (A8629) at a dilution of 1:50 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of ALDH7A1 in paraffin-embedded mouse colon tissue using ALDH7A1 Rabbit pAb (A8629) at a dilution of 1:50 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of ALDH7A1 in paraffin-embedded rat heart tissue using ALDH7A1 Rabbit pAb (A8629) at a dilution of 1:50 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - ALDH7A1 Rabbit pAb (A8629)

Immunofluorescence analysis of HepG2 cells using ALDH7A1 Rabbit pAb (A8629) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	ALDH7A1 Rabbit pAb
Catalog No.	A8629
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is a member of subfamily 7 in the aldehyde dehydrogenase gene family. These enzymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. This particular member has homology to a previously described protein from the green garden pea, the 26g pea turgor protein. It is also involved in lysine catabolism that is known to occur in the mitochondrial matrix. Recent reports show that this protein is found both in the cytosol and the mitochondria, and the two forms likely arise from the use of alternative translation initiation sites. An additional variant encoding a different isoform has also been found for this gene. Mutations in this gene are associated with pyridoxine-dependent epilepsy. Several related pseudogenes have also been identified.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 430-539 of human ALDH7A1 (NP_001173.2).
Sequence	APILYVFKFKNEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGIVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSKDLPLAQGIKFQ
Gene ID
Swiss Prot
Synonyms	EPD; PDE; ATQ1
Calculated MW	58kDa
Observed MW	58kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:100 - 1:500 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Hep G2, Mouse liver, Mouse kidney, Rat liver
Cellular location	Cytoplasm, Mitochondrion, Nucleus, cytosol
Customer validation	WB(Mus musculus)