제품 > 항체 > 다중클론항체(pAb)

ANAPC2 Rabbit pAb (A8066)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of various lysates using ANAPC2 Rabbit pAb (A8066) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunohistochemistry - ANAPC2 Rabbit pAb (A8066)

Immunohistochemistry analysis of paraffin-embedded Rat lung using ANAPC2 Rabbit pAb (A8066) at dilution of 1:300 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Rat spleen using ANAPC2 Rabbit pAb (A8066) at dilution of 1:300 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Overview

Product name	ANAPC2 Rabbit pAb
Catalog No.	A8066
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

A large protein complex, termed the anaphase-promoting complex (APC), or the cyclosome, promotes metaphase-anaphase transition by ubiquitinating its specific substrates such as mitotic cyclins and anaphase inhibitor, which are subsequently degraded by the 26S proteasome. Biochemical studies have shown that the vertebrate APC contains eight subunits. The composition of the APC is highly conserved in organisms from yeast to humans. The product of this gene is a component of the complex and shares sequence similarity with a recently identified family of proteins called cullins, which may also be involved in ubiquitin-mediated degradation.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 400-500 of human ANAPC2 (NP_037498.1).
Sequence	YISAIKALRVLDPSMVILEVACEPIRRYLRTREDTVRQIVAGLTGDSDGTGDLAVELSKTDPASLETGQDSEDDSGEPEDWVPDPVDADPGKSSSKRRSSD
Gene ID
Swiss Prot
Synonyms	APC2; ANAPC2
Calculated MW	94kDa
Observed MW	102kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:100 - 1:500
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Mouse brian, Mouse kidney, Rat brian, Rat kidney
Cellular location	cytosol, nucleoplasm
Customer validation	WB(Homo sapiens, Mus musculus)