제품 > 항체 > 다중클론항체(pAb)

ANT2/SLC25A5 Rabbit pAb (A15639)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat, Monkey

Western blot analysis of various lysates, using ANT2/SLC25A5 Rabbit pAb (A15639) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

ABclonal:Immunohistochemistry - ANT2/SLC25A5 Rabbit pAb (A15639)

Immunohistochemistry analysis of paraffin-embedded Rat heart using ANT2/SLC25A5 Rabbit pAb (A15639) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse heart using ANT2/SLC25A5 Rabbit pAb (A15639) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Overview

Product name	ANT2/SLC25A5 Rabbit pAb
Catalog No.	A15639
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene is a member of the mitochondrial carrier subfamily of solute carrier protein genes. The product of this gene functions as a gated pore that translocates ADP from the cytoplasm into the mitochondrial matrix and ATP from the mitochondrial matrix into the cytoplasm. The protein forms a homodimer embedded in the inner mitochondria membrane. Suppressed expression of this gene has been shown to induce apoptosis and inhibit tumor growth. The human genome contains several non-transcribed pseudogenes of this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 151-250 of human ANT2/SLC25A5(NP_001143.2).
Sequence	EREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHIVISWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKGTDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYT
Gene ID
Swiss Prot
Synonyms	T2; T3; 2F1; AAC2; ANT2; SLC25A5
Calculated MW	33kDa
Observed MW	34kDa

Applications

Reactivity	Human, Mouse, Rat, Monkey
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	PC-3, U-937, COS-7, Neuro-2a, Rat kidney
Cellular location	Mitochondrion inner membrane, Multi-pass membrane protein.
Customer validation	IF(Homo sapiens) WB(Mus musculus)