Reviews (7)Publications (19) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | ATG7 Rabbit pAb |
---|---|
Catalog No. | A0691 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 500-676 of human ATG7 (NP_006386.1). |
---|---|
Sequence | LGFDTFVVMRHGLKKPKQQGAGDLCPNHPVASADLLGSSLFANIPGYKLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAVIAGALAVELMVSVLQHPEGGYAIASSSDDRMNEPPTSLGLVPHQIRGFLSRFDNVLPVSLAFDKCTACSSKVLDQYEREGFNFLAKVFNSSHSFL |
Gene ID | |
Swiss Prot | |
Synonyms | GSA7; APG7L; SCAR31; APG7-LIKE; ATG7 |
Calculated MW | 78kDa |
Observed MW | 78kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Immunohistochemistry Immunofluorescence |
Positive samples | Jurkat, Rat testis |
Cellular location | Cytoplasm, Preautophagosomal structure. |
Customer validation | (Human colon cancer cell, Human chronic myeloid leukemia cells, U-87MG cells, Mouse adenocarcinoma, Mouse cells, HeLa) WB(Mus musculus, Danio rerio, Homo sapiens, Gallus gallus, Sus scrofa , Rattus norvegicus, Sus scrofa) IF(Mus musculus, Sus scrofa) IP(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A0691? Please let us know so that we can cite the reference in this datasheet.