제품 > 항체 > 아세틸화 특이적 항체

Acetyl-Histone H3-K27 Rabbit mAb (A2771)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

Dot-blot analysis of all sorts of peptides using Acetyl-Histone H3-K27 Rabbit mAb (A2771) at 1:200000 dilution.

ABclonal:Western blot - Acetyl-Histone H3-K27 Rabbit mAb (A2771)

Western blot analysis of lysates from C2C12 cells using Acetyl-Histone H3-K27 Rabbit mAb (A2771) at 1:100000 dilution. C2C12 cells were treated by TSA (1 uM) at 37℃ for 18 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 20 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - Acetyl-Histone H3-K27 Rabbit mAb (A2771)

Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using Acetyl-Histone H3-K27 Rabbit mAb (A2771) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using Acetyl-Histone H3-K27 Rabbit mAb (A2771) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human small intestine tissue using Acetyl-Histone H3-K27 Rabbit mAb (A2771) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using Acetyl-Histone H3-K27 Rabbit mAb (A2771) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human liver tissue using Acetyl-Histone H3-K27 Rabbit mAb (A2771) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using Acetyl-Histone H3-K27 Rabbit mAb (A2771) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using Acetyl-Histone H3-K27 Rabbit mAb (A2771) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using Acetyl-Histone H3-K27 Rabbit mAb (A2771) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - Acetyl-Histone H3-K27 Rabbit mAb (A2771)

Immunofluorescence analysis of HeLa treated with TSA and HeLa cells using Acetyl-Histone H3-K27 Rabbit mAb (A2771) at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - Acetyl-Histone H3-K27 Rabbit mAb (A2771)

Immunoprecipitation analysis of 600 μg extracts of Hela TSA cells using 5 μg Acetyl-Histone H3-K27 antibody (A2771). Western blot was performed from the immunoprecipitate using Acetyl-Histone H3-K27 antibody (A2771) at a dilution of 1:50000.

ABclonal:Chromatin Immunoprecipitation - Acetyl-Histone H3-K27 Rabbit mAb (A2771)

Chromatin immunoprecipitation analysis of extracts of HeLa cells, using Acetyl-Histone H3-K27 antibody (A2771) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Review

Overview

Product name	Acetyl-Histone H3-K27 Rabbit mAb
Catalog No.	A2771
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC53670

Background

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Immunogen information

Immunogen	A synthetic acetylated peptide around K27 of human Histone H3 (P68431).
Sequence	MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
Gene ID
Swiss Prot
Synonyms
Calculated MW	15kDa
Observed MW	17kDa

Applications

Reactivity	Human, Mouse, Rat, Other (Wide Range Predicted)
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:10000 - 1:120000 DB 1:500 - 1:2000 IHC-P 1:500 - 1:1000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements. ChIP 2μg antibody for 5μg-10μg of Chromatin
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	C2C12 treated by TSA
Cellular location	Chromosome, Nucleus.
Customer validation	(Tilapia mossambica) ChIP(Mus musculus) Co-IP(Homo sapiens) ChIP(Homo sapiens) WB(Mus musculus)