제품 > 항체 > 아세틸화 특이적 항체

Acetyl-Histone H4-K12 Rabbit mAb (A23683)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

Western blot analysis of lysates from HeLa cells using Acetyl-Histone H4-K12 Rabbit mAb (A23683) at 1:1000 dilution. HeLa cells were treated by 1μM TSA at 37℃ for 18 hours after serum starvation overnight.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 0.5s.

ABclonal:Immunohistochemistry - Acetyl-Histone H4-K12 Rabbit mAb (A23683)

Immunohistochemistry analysis of paraffin-embedded Human colon using Acetyl-Histone H4-K12 Rabbit mAb (A23683) at dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse spleen using Acetyl-Histone H4-K12 Rabbit mAb (A23683) at dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunoprecipitation - Acetyl-Histone H4-K12 Rabbit mAb (A23683)

Immunoprecipitation analysis of 600 μg extracts of HeLa cells using 5 μg Acetyl-Histone H4-K12 Rabbit mAb (A23683). Western blot was performed from the immunoprecipitate using Acetyl-Histone H4-K5 Rabbit mAb (A23080) at a dilition of 1:10000.

ABclonal:Chromatin Immunoprecipitation - Acetyl-Histone H4-K12 Rabbit mAb (A23683)

Chromatin immunoprecipitation analysis of extracts of Hela cells, using Acetyl-Histone H4-K12 antibody (A23683) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Overview

Product name	Acetyl-Histone H4-K12 Rabbit mAb
Catalog No.	A23683
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC57733

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H4 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6.

Immunogen information

Immunogen	A synthetic acetylated peptide around K12 of human Histone H4 (NP_003486.1).
Sequence	MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG
Gene ID
Swiss Prot
Synonyms	H4/I; H4C1; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4FI; H4-16; H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; HIST1H4B; Acetyl-Histone H4-K12
Calculated MW	11kDa
Observed MW	11kDa

Applications

Reactivity	Human, Mouse, Rat, Other (Wide Range Predicted)
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:500 - 1:1000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements. ChIP 5μg antibody for 5μg-10μg of Chromatin
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	HeLa treated by TSA
Cellular location	Chromosome, Nucleus.