제품 > 항체 > 아세틸화 특이적 항체

Acetyl-Histone H4-K16 Rabbit mAb (A23091)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

Western blot analysis of lysates from HeLa cells, using Acetyl-Histone H4-K16 Rabbit mAb (A23091) at 1:8000 dilution. HeLa cells were treated by TSA (1 uM) at 37℃ for 18 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Western blot analysis of lysates from C2C12 cells, using Acetyl-Histone H4-K16 Rabbit mAb (A23091) at 1:8000 dilution. C2C12 cells were treated by TSA (1 uM) at 37℃ for 18 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Western blot analysis of lysates from C6 cells, using Acetyl-Histone H4-K16 Rabbit mAb (A23091) at 1:8000 dilution. C6 cells were treated by TSA (1 uM) at 37℃ for 18 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Dot Blot - Acetyl-Histone H4-K16 Rabbit mAb (A23091)

Dot-blot analysis of all sorts of peptides using Acetyl-Histone H4-K16 antibody (A23091) at 1:500 dilution.

ABclonal:Immunohistochemistry - Acetyl-Histone H4-K16 Rabbit mAb (A23091)

Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using Acetyl-Histone H4-K16 Rabbit mAb (A23091) at a dilution of 1:1200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using Acetyl-Histone H4-K16 Rabbit mAb (A23091) at a dilution of 1:1200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using Acetyl-Histone H4-K16 Rabbit mAb (A23091) at a dilution of 1:1200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using Acetyl-Histone H4-K16 Rabbit mAb (A23091) at a dilution of 1:1200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat lung tissue using Acetyl-Histone H4-K16 Rabbit mAb (A23091) at a dilution of 1:1200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse lung tissue using Acetyl-Histone H4-K16 Rabbit mAb (A23091) at a dilution of 1:1200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Chromatin Immunoprecipitation - Acetyl-Histone H4-K16 Rabbit mAb (A23091)

Chromatin immunoprecipitation analysis of extracts of HeLa cells, using Acetyl-Histone H4-K16 antibody (A23091) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Overview

Product name	Acetyl-Histone H4-K16 Rabbit mAb
Catalog No.	A23091
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC55790

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H4 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6.

Immunogen information

Immunogen	A synthetic acetylated peptide around K16 of human Histone H4 (NP_003529.1).
Sequence	MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG
Gene ID
Swiss Prot
Synonyms	H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4FA; H4-16; H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; HIST1H4A; Acetyl-Histone H4-K16
Calculated MW	11kDa
Observed MW	11kDa

Applications

Reactivity	Human, Mouse, Rat, Other (Wide Range Predicted)
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000-1:9000 DB 1:100 - 1:500 IHC-P 1:1000 - 1:5000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements. ChIP 5μg antibody for 5μg-10μg of Chromatin
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HeLa treated by TSA, C2C12 treated by TSA, C6 treated by TSA
Cellular location	Chromosome, Nucleus.
Customer validation	WB(Homo sapiens) IP(Homo sapiens)