제품 > 항체 > 아세틸화 특이적 항체

Acetyl-Histone H4-K5 Rabbit mAb (A19525)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

Western blot analysis of various lysates using Acetyl-Histone H4-K5 Rabbit mAb (A19525) at 1:1000 dilution. HeLa cells and NIH/3T3 cells and C6 cells were treated by TSA (1 uM) at 37℃ for 18 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Dot Blot - Acetyl-Histone H4-K5 Rabbit mAb (A19525)

Dot-blot analysis of all sorts of peptides using Acetyl-Histone H4-K5 antibody (A19525) at 1:1000 dilution.

ABclonal:Immunohistochemistry - Acetyl-Histone H4-K5 Rabbit mAb (A19525)

Immunohistochemistry analysis of paraffin-embedded Rat brain using Acetyl-Histone H4-K5 Rabbit mAb (A19525) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human appendix using Acetyl-Histone H4-K5 Rabbit mAb (A19525) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse kidney using Acetyl-Histone H4-K5 Rabbit mAb (A19525) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

ABclonal:Immunofluorescence - Acetyl-Histone H4-K5 Rabbit mAb (A19525)

Immunofluorescence analysis of C6 cells using Acetyl-Histone H4-K5 Rabbit mAb (A19525).C6 cells were treated by TSA (1 uM) at 37℃ for 18 hours(left). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH-3T3 cells using Acetyl-Histone H4-K5 Rabbit mAb (A19525).NIH-3T3 cells were treated by TSA (1 uM) at 37℃ for 18 hours(left). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U-2 OS cells using Acetyl-Histone H4-K5 Rabbit mAb (A19525).U-2 OS cells were treated by TSA (1 uM) at 37℃ for 18 hours(left). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	Acetyl-Histone H4-K5 Rabbit mAb
Catalog No.	A19525
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0002

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H4 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element.

Immunogen information

Immunogen	A synthetic acetylated peptide around K5 of human Histone H4 (P62805).
Sequence	MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG
Gene ID
Swiss Prot
Synonyms	H4/p; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4-16; H4C11; H4C12; H4C13; H4C14; H4C15; HIST4H4; Acetyl-Histone H4-K5
Calculated MW	11kDa
Observed MW	11kDa

Applications

Reactivity	Human, Mouse, Rat, Other (Wide Range Predicted)
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 DB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HeLa treated by TSA, NIH/3T3 treated by TSA, C6 treated by TSA
Cellular location	Chromosome, nucleus.
Customer validation	WB(Mus musculus) IF(Mus musculus) Other(Other)