제품 > 항체 > 단일클론항체(mAb)

Aconitase 2 (ACO2) Rabbit mAb (A4524)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using Aconitase 2 (ACO2) (ACO2) Rabbit mAb (A4524) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - Aconitase 2 (ACO2) Rabbit mAb (A4524)

Immunohistochemistry analysis of paraffin-embedded Human colon tissue using Aconitase 2 (ACO2) Rabbit mAb (A4524) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using Aconitase 2 (ACO2) Rabbit mAb (A4524) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using Aconitase 2 (ACO2) Rabbit mAb (A4524) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - Aconitase 2 (ACO2) Rabbit mAb (A4524)

Immunofluorescence analysis of NIH-3T3 cells using Aconitase 2 (ACO2) (ACO2) Rabbit mAb (A4524) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	Aconitase 2 (ACO2) Rabbit mAb
Catalog No.	A4524
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1072

Background

The protein encoded by this gene belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human Aconitase 2 (ACO2) (Q99798).
Sequence	MAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPNEYIHYDLLEKNINIVRKRLNRPLTLSEKIVYGHLDDPASQEIERGKSYLRLRPDRVAMQDATAQMAMLQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEV
Gene ID
Swiss Prot
Synonyms	ICRD; OCA8; OPA9; ACONM; HEL-S-284; Aconitase 2 (ACO2)
Calculated MW	85kDa
Observed MW	85kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IHC-P 1:200 - 1:800 IF/ICC 1:100 - 1:400 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HeLa, Jurkat, SH-SY5Y, Mouse brain, Mouse kidney, Mouse heart, Rat brain, Rat heart
Cellular location	Mitochondrion.
Customer validation	WB(Mus musculus, Homo sapiens)