Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using α-Actin-1 (ACTA1) Rabbit mAb (A2319) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Confocal imaging of U-2 OS cells using α-Actin-1 (ACTA1) Rabbit mAb (A2319, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
Confocal imaging of paraffin-embedded Rat skeletal muscle tissue using α-Actin-1 (ACTA1) Rabbit mAb (A2319, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
Confocal imaging of paraffin-embedded Mouse skeletal muscle tissue using α-Actin-1 (ACTA1) Rabbit mAb (A2319, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
| Product name | α-Actin-1 (ACTA1) Rabbit mAb |
|---|---|
| Catalog No. | A2319 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC1913 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human α-Actin-1 (ACTA1) (P68133). |
|---|---|
| Sequence | MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAP |
| Gene ID | |
| Swiss Prot | |
| Synonyms | ACTA; ASMA; CFTD; MPFD; NEM1; NEM2; NEM3; SHPM; CFTD1; CFTDM; CMYP2A; CMYP2B; CMYP2C; α-Actin-1 (ACTA1) |
| Calculated MW | 42kDa |
| Observed MW | 42kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence |
| Positive samples | HeLa, A-431, RD, C6, Mouse lung, Mouse brain, Mouse heart, Rat lung, Rat heart |
| Cellular location | Cytoplasm, cytoskeleton. |
| Customer validation | WB(Homo sapiens, Arabidopsis thaliana, Rattus norvegicus, Mus musculus, Sus scrofa, Oryctolagus cuniculus, Triticum aestivum) IHC(Homo sapiens) WB(Homo sapiens) IF(Homo sapiens) ChIP(Homo sapiens) Co-IP(Homo sapiens) FC(Homo sapiens) IF(Homo sapiens) RT-qPCR(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A2319? Please let us know so that we can cite the reference in this datasheet.
