Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Immunohistochemistry analysis of paraffin-embedded Mouse cartilage using Aggrecan Rabbit pAb (A8536) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat cartilage using Aggrecan Rabbit pAb (A8536) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human cartilage tissue using Aggrecan Rabbit pAb (A8536) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.
Immunofluorescence analysis of Rat cartilage tissue using Aggrecan Rabbit pAb (A8536) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining.
| Product name | Aggrecan Rabbit pAb |
|---|---|
| Catalog No. | A8536 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 420-575 of human Aggrecan (NP_037359.3). |
|---|---|
| Sequence | FAPEIGATAFAEVENETGEATRPWGFPTPGLGPATAFTSEDLVVQVTAVPGQPHLPGGVVFHYRPGPTRYSLTFEEAQQACLRTGAVIASPEQLQAAYEAGYEQCDAGWLRDQTVRYPIVSPRTPCVGDKDSSPGVRTYGVRPSTETYDVYCFVDR |
| Gene ID | |
| Swiss Prot | |
| Synonyms | AGC1; SEDK; AGCAN; CSPG1; MSK16; CSPGCP; SSOAOD; Aggrecan |
| Calculated MW | 261kDa |
| Observed MW | Refer to figures |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | |
| Cellular location | Secreted, extracellular matrix, extracellular space. |
| Customer validation | WB(Homo sapiens, Rattus norvegicus, Mus musculus, Gallus gallus, Rattus norvegicus, Other) IF(Gallus gallus, Rattus norvegicus, Mus musculus, Homo sapiens) IHC(Homo sapiens, Rattus norvegicus) IF(Homo sapiens, Rattus norvegicus, Rattus norvegicus, Gallus gallus) ChIP(Rattus norvegicus) RT-PCR(Homo sapiens, Rattus norvegicus) IHC(Gallus gallus) WB(Mus musculus) IHC(Homo sapiens,Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A8536? Please let us know so that we can cite the reference in this datasheet.
