제품 > 항체 > 단일클론항체(mAb)

β-Amyloid(1-42) Rabbit mAb (A24422)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Dot-blot analysis of β-Amyloid 1-40 and β-Amyloid 1-42 proteins using β-Amyloid(1-42) Rabbit mAb (A24422) at 1:1000 dilution.

ABclonal:Western blot - β-Amyloid(1-42) Rabbit mAb (A24422)

Western blot analysis of lysates from Recombinant β-Amyloid(1-42) Protein using β-Amyloid(1-42) Rabbit mAb (A24422) at 1:5000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 1 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - β-Amyloid(1-42) Rabbit mAb (A24422)

Immunohistochemistry analysis of paraffin-embedded 5XFAD Mouse brain (model for Alzheimer disease, Left) and BALB/c Mouse brain (normal, Right) using β-Amyloid(1-42) Rabbit mAb (A24422) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - β-Amyloid(1-42) Rabbit mAb (A24422)

Confocal imaging of paraffin-embedded 5XFAD Mouse brain (model for Alzheimer disease, left) and BALB/c Mouse brain (normal, right) tissue using β-Amyloid(1-42) Rabbit mAb (A24422, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining. Objective: 40x.

Overview

Product name	β-Amyloid(1-42) Rabbit mAb
Catalog No.	A24422
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC63663

Background

This gene encodes a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. In addition, two of the peptides are antimicrobial peptides, having been shown to have bacteriocidal and antifungal activities. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 691-770 of human β-Amyloid(NP_000475.1).
Sequence	FAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN
Gene ID
Swiss Prot
Synonyms	AAA; AD1; PN2; ABPP; APPI; CVAP; ABETA; PN-II; preA4; CTFgamma; alpha-sAPP; β-Amyloid(1-42)
Calculated MW	87kDa
Observed MW	21.4kDa

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	DB 1:500 - 1:1000 IHC-P 1:200 - 1:800 IF/ICC 1:200 - 1:800 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Immunohistochemistry Immunofluorescence
Positive samples	Recombinant β-Amyloid(1-42) Protein
Cellular location	Membrane, Single-pass type I membrane protein, clathrin-coated pit.