Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Arginase 1 (ARG1) Rabbit mAb |
---|---|
Catalog No. | A4923 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC1164 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Arginase 1 (ARG1) (P05089). |
---|---|
Sequence | MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGD |
Gene ID | |
Swiss Prot | |
Synonyms | ARG1; arginase-1; Arginase 1 (ARG1) |
Calculated MW | 35kDa |
Observed MW | 40kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | Rat liver |
Cellular location | Cytoplasm, nuclear. |
Customer validation | WB(Mus musculus, Homo sapiens, Rattus norvegicus, Mus musculus) IHC(Sus scrofa, Mus musculus, Rattus norvegicus) IF(Mus musculus, Homo sapiens) IF(Homo sapiens, Rattus norvegicus) WB(Mus musculus) WB (Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A4923? Please let us know so that we can cite the reference in this datasheet.