제품 > 항체 > 단일클론항체(mAb)

Aromatase (CYP19A1) Rabbit mAb (A12238)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from U-87MG cells, using Aromatase (CYP19A1) Rabbit mAb (A12238) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Immunohistochemistry - Aromatase (CYP19A1) Rabbit mAb (A12238)

Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using Aromatase (CYP19A1) Rabbit mAb (A12238) at a dilution of 1:4000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human placenta tissue using Aromatase (CYP19A1) Rabbit mAb (A12238) at a dilution of 1:4000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.

ABclonal:Immunofluorescence - Aromatase (CYP19A1) Rabbit mAb (A12238)

Immunofluorescence analysis of paraffin-embedded human placenta using Aromatase (CYP19A1) Rabbit mAb (A12238) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	Aromatase (CYP19A1) Rabbit mAb
Catalog No.	A12238
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0635

Background

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and catalyzes the last steps of estrogen biosynthesis. Mutations in this gene can result in either increased or decreased aromatase activity; the associated phenotypes suggest that estrogen functions both as a sex steroid hormone and in growth or differentiation. Alternative promoter use and alternative splicing results in multiple transcript variants that have different tissue specificities.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Aromatase (CYP19A1) (P11511).
Sequence	MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLISHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKS
Gene ID
Swiss Prot
Synonyms	ARO; ARO1; CPV1; CYAR; CYP19; CYPXIX; P-450AROM; Aromatase (CYP19A1)
Calculated MW	58kDa
Observed MW	58kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IHC-P 1:800 - 1:8000 IF/ICC 1:100 - 1:400 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	U-87MG
Cellular location	endoplasmic reticulum.
Customer validation	WB(Mus musculus)