Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | Aromatase (CYP19A1) Rabbit mAb |
---|---|
Catalog No. | A12238 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0635 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Aromatase (CYP19A1) (P11511). |
---|---|
Sequence | MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLISHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKS |
Gene ID | |
Swiss Prot | |
Synonyms | ARO; ARO1; CPV1; CYAR; CYP19; CYPXIX; P-450AROM; Aromatase (CYP19A1) |
Calculated MW | 58kDa |
Observed MW | 58kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | U-87MG |
Cellular location | endoplasmic reticulum. |
Customer validation | WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A12238? Please let us know so that we can cite the reference in this datasheet.