Reviews (2)Publications (6) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Aurora B Rabbit mAb |
---|---|
Catalog No. | A19539 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC50905 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Aurora B (NP_004208.2). |
---|---|
Sequence | MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSH |
Gene ID | |
Swiss Prot | |
Synonyms | AIK2; AIM1; ARK2; AurB; IPL1; STK5; AIM-1; ARK-2; STK-1; STK12; PPP1R48; aurkb-sv1; aurkb-sv2; Aurora B |
Calculated MW | 39kDa |
Observed MW | 39kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | MCF7, HepG2, A-549 |
Cellular location | Chromosome, Cytoplasm, Midbody, Nucleus, centromere, cytoskeleton, spindle. |
Customer validation | (Hela,A549, 293T hela hepg2 jurkat RPMI-8228 PC3) IF(Homo sapiens) WB(Homo sapiens, Mus musculus) IP(Homo sapiens) IHC(Mus musculus) IF(Mus musculus) IHC(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A19539? Please let us know so that we can cite the reference in this datasheet.