Reviews (2)Publications (18) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using BNIP3 Rabbit pAb (A5683) at 1:1000 dilution incubated overnight at 4℃. Hela and NIH/3T3 cells were treated by Cobalt chloride (0.1 mM) at 37℃ for 4 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 30 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.
Immunohistochemistry analysis of paraffin-embedded Mouse stomach using BNIP3 Rabbit pAb (A5683) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat stomach using BNIP3 Rabbit pAb (A5683) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
| Product name | BNIP3 Rabbit pAb |
|---|---|
| Catalog No. | A5683 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 40-120 of human BNIP3 (NP_004043.3). |
|---|---|
| Sequence | AFPPPAAEAHPAARRGLRSPQLPSGAMSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESG |
| Gene ID | |
| Swiss Prot | |
| Synonyms | NIP3; HABON; BNIP3 |
| Calculated MW | 22kDa |
| Observed MW | 22-70kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry |
| Positive samples | HeLa, NIH/3T3 |
| Cellular location | Mitochondrion, Mitochondrion outer membrane, Single-pass membrane protein. |
| Customer validation | (Mouse heart, Human Isikawa ) IHC(Mus musculus) WB(Homo sapiens, Mus musculus, Rattus norvegicus, Mus musculus, Other) IF(Mus musculus) WB(Mus musculus) IF(Rattus norvegicus, Mus musculus) IHC(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A5683? Please let us know so that we can cite the reference in this datasheet.
