Reviews (2)Publications (19) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | BNIP3 Rabbit pAb |
---|---|
Catalog No. | A5683 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 40-120 of human BNIP3 (NP_004043.3). |
---|---|
Sequence | AFPPPAAEAHPAARRGLRSPQLPSGAMSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESG |
Gene ID | |
Swiss Prot | |
Synonyms | NIP3; HABON; BNIP3 |
Calculated MW | 22kDa |
Observed MW | 22-70kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | HeLa, NIH/3T3 |
Cellular location | Mitochondrion, Mitochondrion outer membrane, Single-pass membrane protein. |
Customer validation | (Mouse heart, Human Isikawa ) IHC(Mus musculus) WB(Homo sapiens, Mus musculus, Rattus norvegicus, Mus musculus, Other, Ctenopharyngodon idellus) IF(Mus musculus) WB(Mus musculus) IF(Rattus norvegicus, Mus musculus) IHC(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A5683? Please let us know so that we can cite the reference in this datasheet.