Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | Bak Rabbit mAb |
---|---|
Catalog No. | A10754 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0014 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 11-82 of human Bak (NP_001179.1). |
---|---|
Sequence | RQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIG |
Gene ID | |
Swiss Prot | |
Synonyms | BAK; CDN1; BCL2L7; BAK-LIKE; Bak |
Calculated MW | 23kDa |
Observed MW | 25kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HeLa, THP-1 |
Cellular location | Mitochondrion membrane, Single-pass membrane protein. |
Customer validation | WB(Homo sapiens ) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A10754? Please let us know so that we can cite the reference in this datasheet.