Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Bcl-2 Rabbit pAb |
---|---|
Catalog No. | A11025 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-239 of human Bcl-2 (NP_000624.2). |
---|---|
Sequence | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK |
Gene ID | |
Swiss Prot | |
Synonyms | Bcl-2; PPP1R50 |
Calculated MW | 26kDa |
Observed MW | 26kDa/ |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | Mouse liver, Rat spleen, 293T, THP-1 |
Cellular location | Endoplasmic reticulum membrane, Mitochondrion outer membrane, Nucleus membrane, Single-pass membrane protein. |
Customer validation | WB(Homo sapiens, Mus musculus, Rattus norvegicus, gallus gallus, Bos taurus, Other) IHC(Homo sapiens) IF(Rattus norvegicus) IF(Bos taurus) FC(Bos taurus) ELISA(Bos taurus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A11025? Please let us know so that we can cite the reference in this datasheet.