Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | CD11b/ITGAM Rabbit pAb |
---|---|
Catalog No. | A1581 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 145-340 of CD11b/ITGAM (NP_000623.2). |
---|---|
Sequence | PQEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFNITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQVNNFEALKTIQNQLREKIFAIEGTQT |
Gene ID | |
Swiss Prot | |
Synonyms | CR3A; MO1A; CD11B; MAC-1; MAC1A; SLEB6; CD11b/ITGAM |
Calculated MW | 127kDa |
Observed MW | 170kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | THP-1, U-937, Mouse lung, Mouse brain, Mouse spleen, Rat lung |
Cellular location | Membrane, Single-pass type I membrane protein. |
Customer validation | FC(Homo sapiens) IF(Mus musculus, Homo sapiens, Rattus norvegicus, Mus musculus) IHC(Mus musculus, Homo sapiens, Rattus norvegicus) WB(Mus musculus, Rattus norvegicus) IF(Mus musculus, Rattus norvegicus) FC(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A1581? Please let us know so that we can cite the reference in this datasheet.