제품 > 항체 > 단일클론항체(mAb)

CD132/IL-2 R gamma Rabbit mAb (A22037)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of extracts of various cell lines, using CD132/IL-2 R gamma antibody (A22037) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

Overview

Product name	CD132/IL-2 R gamma Rabbit mAb
Catalog No.	A22037
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC54566

Background

The protein encoded by this gene is an important signaling component of many interleukin receptors, including those of interleukin -2, -4, -7 and -21, and is thus referred to as the common gamma chain. Mutations in this gene cause X-linked severe combined immunodeficiency (XSCID), as well as X-linked combined immunodeficiency (XCID), a less severe immunodeficiency disorder.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CD132/IL-2 R gamma (NP_000197.1).
Sequence	TSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASP
Gene ID
Swiss Prot
Synonyms	P64; CIDX; IMD4; CD132; SCIDX; IL-2RG; SCIDX1
Calculated MW	42kDa
Observed MW	50-70kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Jurkat, Mouse spleen, Mouse thymus
Cellular location	Membrane, Cell surface