제품 > 항체 > 단일클론항체(mAb)

CD272/BTLA Rabbit mAb (A24611)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Western blot analysis of various lysates, using CD272/BTLA Rabbit mAb (A24611) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Flow CytoMetry - CD272/BTLA Rabbit mAb (A24611)

Flow cytometry: 1X10^6 C2C12 cells (negative control, left) and C57/BL6 splenocytes (right) were surface-stained with CD272/BTLA Rabbit mAb (A24611, 2 μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, blue line), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 C57/BL6 splenocytes were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, left) or CD272/BTLA Rabbit mAb (A24611, 2 μg/mL, right).

Overview

Product name	CD272/BTLA Rabbit mAb
Catalog No.	A24611
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC63351

Background

Enables signaling receptor activity. Acts upstream of or within immune response-regulating cell surface receptor signaling pathway; negative regulation of B cell proliferation; and negative regulation of alpha-beta T cell proliferation. Located in external side of plasma membrane. Is integral component of plasma membrane. Orthologous to human BTLA (B and T lymphocyte associated).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 30-176 of mouse CD272/BTLA (NP_001032808.2).
Sequence	EKATKRNDEECPVQLTITRNSKQSARTGELFKIQCPVKYCVHRPNVTWCKHNGTICVPLEVSPQLYTSWEENQSVPVFVLHFKPIHLSDNGSYSCSTNFNSQVINSHSVTIHVRERTQNSSEHPLITVSDIPDATNASGPSTMEERP
Gene ID
Swiss Prot
Synonyms	A630002H24; CD272/BTLA
Calculated MW	34kDa
Observed MW	50-70kDa

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 FC 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Flow Cytometry
Positive samples	A20, Mouse spleen
Cellular location	Membrane, Single-pass type I membrane protein

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CD272/BTLA Rabbit mAb images

Western blot - CD272/BTLA Rabbit mAb (A24611)

Flow CytoMetry - CD272/BTLA Rabbit mAb (A24611)

Flow cytometry: 1X10^6 C57/BL6 splenocytes were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, left) or CD272/BTLA Rabbit mAb (A24611, 2 μg/mL, right).

* For research use only. Not for therapeutic or diagnostic purposes.