Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using CD34 Rabbit mAb (A19015) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using CD34 Rabbit mAb (A19015) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human kidney using CD34 Rabbit mAb (A19015) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human lung cancer using CD34 Rabbit mAb (A19015) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
| Product name | CD34 Rabbit mAb |
|---|---|
| Catalog No. | A19015 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC0219 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 286-385 of human CD34 (P28906). |
|---|---|
| Sequence | YSQKTLIALVTSGALLAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQENGTGQATSRNGHSARQHVVADTEL |
| Gene ID | |
| Swiss Prot | |
| Synonyms | CD34; CD34 molecule; GIG3; MORT1 |
| Calculated MW | 41kDa |
| Observed MW | 120kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry |
| Positive samples | Mouse testis, Rat lung |
| Cellular location | Membrane, Single-pass type I membrane protein. |
| Customer validation | WB(Mus musculus, Homo sapiens, Mus musculus) IHC(Homo sapiens, Rattus norvegicus) IF(Rattus norvegicus, Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19015? Please let us know so that we can cite the reference in this datasheet.
Y_IF_01.jpg?t=1721359241)
i_IF_01.jpg?t=1721359217)
i_IF_01.jpg?t=1721359249)
