Reviews (2)Publications (12) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Rat
Western blot analysis of lysates from Rat heart, using CD34 Rabbit pAb (A0761) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Western blot analysis of lysates from TF-1 cells using CD34 Rabbit pAb (A0761) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:30s.
Immunohistochemistry analysis of paraffin-embedded Human placenta using CD34 Rabbit pAb (A0761) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human spleen tissue using CD34 Rabbit pAb (A0761) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using CD34 Rabbit pAb (A0761) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using CD34 Rabbit pAb (A0761) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using CD34 Rabbit pAb (A0761) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
Immunofluorescence analysis of paraffin-embedded human placenta using CD34 Rabbit pAb (A0761) at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of paraffin-embedded Human placenta tissue using CD34 Rabbit pAb(A0761) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
| Product name | CD34 Rabbit pAb |
|---|---|
| Catalog No. | A0761 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 32-290 of human CD34 (NP_001020280.1). |
|---|---|
| Sequence | SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKT |
| Gene ID | |
| Swiss Prot | |
| Synonyms | CD34; CD34 molecule; GIG3; MORT1 |
| Calculated MW | 41kDa |
| Observed MW | 105kDa |
| Reactivity | Human, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | Rat heart |
| Cellular location | Membrane, Single-pass type I membrane protein |
| Customer validation | (Mouse liver, Human prostate) WB(Homo sapiens, Mus musculus, Rattus norvegicus) FC(Homo sapiens) IHC(Homo sapiens, Mus musculus, Rattus norvegicus, Mus musculus) IF(Rattus norvegicus) IF(Rattus norvegicus, Homo sapiens, Mus musculus) IHC(Mus musculus) mIHC(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A0761? Please let us know so that we can cite the reference in this datasheet.
Y_IF_01.jpg?t=1721359241)
i_IF_01.jpg?t=1721359217)
i_IF_01.jpg?t=1721359249)
