Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using CD36/SR-B3 Rabbit pAb (A5792) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunohistochemistry analysis of CD36/SR-B3 in paraffin-embedded human liver tissue using CD36/SR-B3 Rabbit pAb (A5792) at a dilution of 1:300 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of CD36/SR-B3 in paraffin-embedded human spleen tissue using CD36/SR-B3 Rabbit pAb (A5792) at a dilution of 1:300 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunofluorescence analysis of paraffin-embedded Human spleen tissue using CD36/SR-B3 Rabbit pAb(A5792) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
| Product name | CD36/SR-B3 Rabbit pAb |
|---|---|
| Catalog No. | A5792 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-439 of human CD36/SR-B3 (NP_000063.2). |
|---|---|
| Sequence | GDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKIN |
| Gene ID | |
| Swiss Prot | |
| Synonyms | FAT; GP4; GP3B; GPIV; CHDS7; PASIV; SCARB3; BDPLT10; CD36/SR-B3 |
| Calculated MW | 53kDa |
| Observed MW | 70-110kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | Mouse heart, Rat heart |
| Cellular location | Cell membrane, Multi-pass membrane protein |
| Customer validation | WB(Mus musculus, Rattus norvegicus, Gallus gallus, Homo sapiens) IF(Mus musculus) IF(Mus musculus) Other(Homo sapiens) IHC(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A5792? Please let us know so that we can cite the reference in this datasheet.
_IF_01.jpg?t=1705994969 "ABclonal:Immunofluorescence - CD36/SR-B3 Rabbit pAb (A5792)")
