Reviews (2)Publications (11) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of lysates from Jurkat cells, using CD45 Rabbit pAb (A2115) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry analysis of paraffin-embedded Human colon using CD45 Rabbit pAb (A2115) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human liver cancer using CD45 Rabbit pAb (A2115) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunofluorescence analysis of Jurkat cells using CD45 Rabbit pAb (A2115) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Product name | CD45 Rabbit pAb |
|---|---|
| Catalog No. | A2115 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 194-390 of human CD45 (NP_002829.3). |
|---|---|
| Sequence | SDAYLNASETTTLSPSGSAVISTTTIATTPSKPTCDEKYANITVDYLYNKETKLFTAKLNVNENVECGNNTCTNNEVHNLTECKNASVSISHNSCTAPDKTLILDVPPGVEKFQLHDCTQVEKADTTICLKWKNIETFTCDTQNITYRFQCGNMIFDNKEIKLENLEPEHEYKCDSEILYNNHKFTNASKIIKTDFG |
| Gene ID | |
| Swiss Prot | |
| Synonyms | LCA; LY5; B220; CD45; L-CA; T200; CD45R; GP180; IMD105 |
| Calculated MW | 147kDa |
| Observed MW | 180-240kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | Jurkat |
| Cellular location | Membrane, Membrane raft, Single-pass type I membrane protein. |
| Customer validation | (Human chronic myeloid leukemia cells) FC(Homo sapiens) IHC(Mus musculus, Homo sapiens, Rattus norvegicus) WB(Mus musculus) IF(Mus musculus, Rattus norvegicus) IF(Rattus norvegicus) IHC(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A2115? Please let us know so that we can cite the reference in this datasheet.
K1_FC_01.jpg?t=1717139812)
i_FC_01.jpg?t=1709085046)
i_FC_01.jpg?t=1721358909)
A1_FC_01.jpg?t=1714293876)
m10_FC_01.jpg?t=1717139538)
Y_FC_01.jpg?t=1712649645)
Y_FC_01.jpg?t=1700554728)
i_FC_01.jpg?t=1702466775)
