제품 > 항체 > 단일클론항체(mAb)

CD47 Rabbit mAb (A11382)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

ABclonal:Western blot - CD47 Rabbit mAb (A11382)

Western blot analysis of various lysates using CD47 Rabbit mAb (A11382) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

Overview

Product name	CD47 Rabbit mAb
Catalog No.	A11382
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0584

Background

This gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes. Alternatively spliced transcript variants have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 224-323 of human CD47 (Q08722).
Sequence	HYYVFSTAIGLTSFVIAILVIQVIAYILAVVGLSLCIAACIPMHGPLLISGLSILALAQLLGLVYMKFVASNQKTIQPPRKAVEEPLNAFKESKGMMNDE
Gene ID
Swiss Prot
Synonyms	IAP; OA3; MER6; CD47
Calculated MW	35kDa
Observed MW	50kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	U-2 OS
Cellular location	Cell membrane, Multi-pass membrane protein.
Customer validation	WB(Mus musculus) IHC(Homo sapiens)