Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | CD68 Rabbit mAb |
---|---|
Catalog No. | A20803 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC51150 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD68 (NP_001242.2). |
---|---|
Sequence | TSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNK |
Gene ID | |
Swiss Prot | |
Synonyms | GP110; LAMP4; SCARD1; CD68 |
Calculated MW | 37kDa |
Observed MW | 80-130kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | Raji, THP-1, U-937, RAW264.7, Mouse spleen |
Cellular location | Cell membrane, Endosome membrane, Lysosome membrane, Single-pass type I membrane protein, Single-pass type I membrane protein. |
Customer validation | IHC(Homo sapiens, Mus musculus) WB(Mus musculus) IF(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A20803? Please let us know so that we can cite the reference in this datasheet.