Review (1)Publications (26) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | CD81 Rabbit pAb |
---|---|
Catalog No. | A5270 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 114-199 of human CD81 (NP_004347.1). |
---|---|
Sequence | VNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFS |
Gene ID | |
Swiss Prot | |
Synonyms | S5.7; CVID6; TAPA1; TSPAN28; CD81 |
Calculated MW | 26kDa |
Observed MW | 22kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | Raji, Mouse brain |
Cellular location | Membrane, Multi-pass membrane protein. |
Customer validation | (HeLa cells) WB(Homo sapiens, Gallus gallus, Rattus norvegicus, Mus musculus, Cynoglossus semilaevis, Sus scrofa, Arabidopsis thaliana) IF(Homo sapiens,Mus musculus, Homo sapiens, Rattus norvegicus) WB(Homo sapiens,Mus musculus) IF(Mus musculus) IHC(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A5270? Please let us know so that we can cite the reference in this datasheet.