제품 > 항체 > 단일클론항체(mAb)

CD95 Rabbit mAb (A24075)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 L-929 cells (Low Expression, left) and A20 cells (right) were surface-stained with CD95 Rabbit mAb (A24075, 2 μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 A20 cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or CD95 Rabbit mAb (A24075, 2 μg/mL, right).

Overview

Product name	CD95 Rabbit mAb
Catalog No.	A24075
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC61283

Background

CD95, also known as Fas, is a approximately 45 kD type I transmembrane protein in the TNFR superfamily (TNFRSF6). CD95 was expressed in thymus, spleen, liver, heart, lung, ovary and other organs. CD95 binds ligand (FasL) to form a death-inducing signaling complex (DISC) in cells to induce apoptosis. Cd95-induced apoptosis plays an important role in development and in maintaining peripheral tolerance of the immune system.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 22-169 of CD95(NP_032013.2).
Sequence	QGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNR
Gene ID
Swiss Prot
Synonyms	lpr; APO1; APT1; CD95; TNFR6; Tnfrsf6
Calculated MW	37kDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	cytomembrane、cytoplasm

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CD95 Rabbit mAb images

Flow CytoMetry - CD95 Rabbit mAb (A24075)

Flow cytometry: 1X10^6 A20 cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or CD95 Rabbit mAb (A24075, 2 μg/mL, right).

* For research use only. Not for therapeutic or diagnostic purposes.