Reviews (2)Publications (20) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | CD9 Rabbit mAb |
---|---|
Catalog No. | A19027 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0330 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 129-228 of human CD9 (P21926). |
---|---|
Sequence | YNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV |
Gene ID | |
Swiss Prot | |
Synonyms | MIC3; MRP-1; BTCC-1; DRAP-27; TSPAN29; TSPAN-29; CD9 |
Calculated MW | 25kDa |
Observed MW | 25kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunoprecipitation |
Positive samples | THP-1, K-562, Mouse brain, Mouse kidney |
Cellular location | Cell membrane, Membrane, Multi-pass membrane protein. |
Customer validation | (Remas 、Jurkat, CK(MSC-A-),Y-1 serum EVs) WB(Homo sapiens, Mus musculus, Mus musculus, Other) IF(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A19027? Please let us know so that we can cite the reference in this datasheet.