Reviews (4)Publications (33) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | CDK1 Rabbit pAb |
---|---|
Catalog No. | A0220 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 198-297 of human CDK1 (NP_001777.1). |
---|---|
Sequence | ATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM |
Gene ID | |
Swiss Prot | |
Synonyms | CDC2; CDC28A; P34CDC2; CDK1 |
Calculated MW | 34kDa |
Observed MW | 34kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
Positive samples | Jurkat, C6, Mouse spleen |
Cellular location | Cytoplasm, Mitochondrion, Nucleus, centrosome, cytoskeleton, microtubule organizing center, spindle. |
Customer validation | (Human gastric cancer cells, Human tumor cell, HeLa, HCT116) WB(Homo sapiens, Rattus norvegicus, Mus musculus, Sus scrofa, Mus musculus, ) IF(Homo sapiens) IP(Homo sapiens, Rattus norvegicus) IHC(Homo sapiens, Mus musculus,) IHC(Rattus norvegicus) WB(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A0220? Please let us know so that we can cite the reference in this datasheet.