제품 > 항체 > 단일클론항체(mAb)

CDKN2A/p19ARF Rabbit mAb (A26879)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of various lysates using CDKN2A/p19ARF Rabbit mAb (A26879)at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): NIH/3T3
Exposure time: 0.5s.

ABclonal:Immunohistochemistry - CDKN2A/p19ARF Rabbit mAb (A26879)

Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using CDKN2A/p19ARF Rabbit mAb (A26879) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using CDKN2A/p19ARF Rabbit mAb (A26879) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - CDKN2A/p19ARF Rabbit mAb (A26879)

Confocal imaging of paraffin-embedded Mouse brain tissue using CDKN2A/p19ARF Rabbit mAb (A26879, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.

Overview

Product name	CDKN2A/p19ARF Rabbit mAb
Catalog No.	A26879
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC62846

Background

Enables MDM2/MDM4 family protein binding activity; enzyme inhibitor activity; and protein N-terminus binding activity. Involved in several processes, including negative regulation of lymphocyte proliferation; positive regulation of apoptotic process; and regulation of transcription, DNA-templated. Acts upstream of or within several processes, including negative regulation of cellular protein metabolic process; negative regulation of mammary gland epithelial cell proliferation; and positive regulation of apoptotic process involved in mammary gland involution. Located in cytoplasm and granular component. Part of protein-containing complex. Is expressed in several structures, including bone marrow; central nervous system; dorsal root ganglion; eye; and testis. Human ortholog(s) of this gene implicated in several diseases, including breast cancer (multiple); carcinoma (multiple); hematologic cancer (multiple); melanoma (multiple); and nervous system cancer (multiple). Orthologous to human CDKN2A (cyclin dependent kinase inhibitor 2A).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse CDKN2A/p19ARF (NP_034007.1).
Sequence	MGRRFLVTVRIQRAGRPLQERVFLVKFVRSRRPRTASCALAFVNMLLRLERILRRGPHRNPGPGDDDGQRSRSSSSAQLRCRFELRGPHYLLPPGARRSA
Gene ID
Swiss Prot
Synonyms	Arf; p16; MTS1; Pctr1; p19ARF; p16INK4a; p19; ARF-INK4a; INK4a-ARF; Ink4a/Arf; p16(INK4a); CDKN2A/p19ARF
Calculated MW	19KDa
Observed MW	21kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:10000 IHC-P 1:300 - 1:1200 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	A20
Cellular location	Nucleus, nucleoplasm.