Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | CEBPA Rabbit pAb |
---|---|
Catalog No. | A0904 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 111-180 of human CEBPA (NP_004355.2). |
---|---|
Sequence | APAGPGGAVMPGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFP |
Gene ID | |
Swiss Prot | |
Synonyms | CEBP; C/EBP-alpha; CEBPA |
Calculated MW | 38kDa |
Observed MW | 30kDa/42kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | LO2, Mouse kidney, Rat lung, Rat kidney |
Cellular location | Nucleus, Nucleus, nucleolus. |
Customer validation | WB(Homo sapiens, Sus scrofa, Mus musculus, Oryctolagus cuniculus, Rattus norvegicus) RT-qPCR(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A0904? Please let us know so that we can cite the reference in this datasheet.