제품 > 항체 > 다중클론항체(pAb)

CHD4 Rabbit pAb (A11574)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using CHD4 Rabbit pAb (A11574) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - CHD4 Rabbit pAb (A11574)

Immunohistochemistry analysis of paraffin-embedded rat liver using CHD4 Rabbit pAb (A11574) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human oophoroma using CHD4 Rabbit pAb (A11574) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse liver using CHD4 Rabbit pAb (A11574) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - CHD4 Rabbit pAb (A11574)

Immunofluorescence analysis of C6 cells using CHD4 Rabbit pAb (A11574) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of L929 cells using CHD4 Rabbit pAb (A11574) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U20S cells using CHD4 Rabbit pAb (A11574) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	CHD4 Rabbit pAb
Catalog No.	A11574
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The product of this gene belongs to the SNF2/RAD54 helicase family. It represents the main component of the nucleosome remodeling and deacetylase complex and plays an important role in epigenetic transcriptional repression. Patients with dermatomyositis develop antibodies against this protein. Somatic mutations in this gene are associated with serous endometrial tumors. Alternative splicing results in multiple transcript variants encoding different isoforms.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1520-1690 of human CHD4 (NP_001264.2).
Sequence	ELAEVEENKKMSQPGSPSPKTPTPSTPGDTQPNTPAPVPPAEDGIKIEENSLKEEESIEGEKEVKSTAPETAIECTQAPAPASEDEKVVVEPPEGEEKVEKAEVKERTEEPMETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEEEEKKEVMLQNGETPKDLNDEKQKK
Gene ID
Swiss Prot
Synonyms	CHD-4; Mi-2b; SIHIWES; Mi2-BETA; CHD4
Calculated MW	218kDa
Observed MW	280kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:100 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HeLa, Jurkat, 293T, HT-1080
Cellular location	Cytoplasm, Nucleus, centrosome, cytoskeleton, microtubule organizing center