제품 > 항체 > 다중클론항체(pAb)

CHMP6 Rabbit pAb (A4975)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of extracts of various cell lines, using CHMP6 antibody (A4975) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - CHMP6 Rabbit pAb (A4975)

Immunofluorescence analysis of NIH/3T3 cells using CHMP6 Rabbit pAb (A4975) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	CHMP6 Rabbit pAb
Catalog No.	A4975
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a member of the chromatin-modifying protein/charged multivesicular body protein family. Proteins in this family are part of the ESCRT-III (endosomal sorting complex required for transport III) which degrades surface receptors, and in biosynthesis of endosomes.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 111-200 of human CHMP6 (NP_078867.2).
Sequence	LNKMHQVMSIEEVERILDETQEAVEYQRQIDELLAGSFTQEDEDAILEELSAITQEQIELPEVPSEPLPEKIPENVPVKARPRQAELVAA
Gene ID
Swiss Prot
Synonyms	VPS20
Calculated MW	23kDa
Observed MW	30kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	U2OS, PC-3, Jurkat
Cellular location	Endomembrane system, Endosome membrane, Late endosome membrane, Lipid-anchor, Membrane
Customer validation	WB(Homo sapiens)