Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | COX IV Rabbit mAb |
---|---|
Catalog No. | A11631 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC2518 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human COX IV (P13073). |
---|---|
Sequence | MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEW |
Gene ID | |
Swiss Prot | |
Synonyms | COX4; COXIV; COX4-1; COXIV-1; MC4DN16; COX IV-1; COX IV |
Calculated MW | 20kDa |
Observed MW | 17kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | HeLa, MCF7, Mouse brain, Mouse heart, Rat heart |
Cellular location | Mitochondrion inner membrane. |
Customer validation | WB(Rattus norvegicus, Homo sapiens, Cyprinus carpio, Mus musculus) IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A11631? Please let us know so that we can cite the reference in this datasheet.