Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | CTSK Rabbit pAb |
---|---|
Catalog No. | A1782 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 115-329 of human CTSK (NP_000387.1). |
---|---|
Sequence | APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM |
Gene ID | |
Swiss Prot | |
Synonyms | CTSO; PKND; PYCD; CTS02; CTSO1; CTSO2; CTSK |
Calculated MW | 37kDa |
Observed MW | 26kDa/37kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | SK-MEL-28, U-87MG, MG-63 |
Cellular location | Lysosome. |
Customer validation | WB(Rattus norvegicus, Meretrix meretrix, Homo sapiens, Mus musculus) IF(Mus musculus) IHC(Mus musculus) WB(Mus musculus) qPCR(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A1782? Please let us know so that we can cite the reference in this datasheet.