제품 > 항체 > 다중클론항체(pAb)

CXCL4/PF4 Rabbit pAb (A17376)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using CXCL4/PF4 Rabbit pAb (A17376) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Immunohistochemistry - CXCL4/PF4 Rabbit pAb (A17376)

Immunohistochemistry analysis of paraffin-embedded Rat bone marrow using CXCL4/PF4 Rabbit pAb (A17376) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - CXCL4/PF4 Rabbit pAb (A17376)

Immunofluorescence analysis of paraffin-embedded rat bone marrow using CXCL4/PF4 Rabbit pAb (A17376) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	CXCL4/PF4 Rabbit pAb
Catalog No.	A17376
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a member of the CXC chemokine family. This chemokine is released from the alpha granules of activated platelets in the form of a homotetramer which has high affinity for heparin and is involved in platelet aggregation. This protein is chemotactic for numerous other cell type and also functions as an inhibitor of hematopoiesis, angiogenesis and T-cell function. The protein also exhibits antimicrobial activity against Plasmodium falciparum.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 32-101 of human CXCL4/PF4 (NP_002610.1).
Sequence	EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Gene ID
Swiss Prot
Synonyms	PF-4; CXCL4; SCYB4; CXCL4/PF4
Calculated MW	11kDa
Observed MW	10kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:100 - 1:500 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Mouse spleen, Rat lung, Rat spleen, Rat plasma
Cellular location	cytoplasm, extracellular region, extracellular space.
Customer validation	IF(Mus musculus)