Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | CYP1A2 Rabbit pAb |
---|---|
Catalog No. | A0062 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 205-305 of human CYP1A2 (NP_000752.2). |
---|---|
Sequence | FGQHFPESSDEMLSLVKNTHEFVETASSGNPLDFFPILRYLPNPALQRFKAFNQRFLWFLQKTVQEHYQDFDKNSVRDITGALFKHSKKGPRASGNLIPQE |
Gene ID | |
Swiss Prot | |
Synonyms | CP12; CYPIA2; P3-450; P450(PA) |
Calculated MW | 58kDa |
Observed MW | 54kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | Mouse liver, Rat liver |
Cellular location | Endoplasmic reticulum membrane, Microsome membrane, Peripheral membrane protein |
Customer validation | WB(Rattus norvegicus, Homo sapiens, Mus musculus) FC(Mus musculus) WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A0062? Please let us know so that we can cite the reference in this datasheet.