Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | CYP7A1 Rabbit pAb |
---|---|
Catalog No. | A10615 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 390-504 of human CYP7A1 (NP_000771.2). |
---|---|
Sequence | YPQLMHLDPEIYPDPLTFKYDRYLDENGKTKTTFYCNGLKLKYYYMPFGSGATICPGRLFAIHEIKQFLILMLSYFELELIEGQAKCPPLDQSRAGLGILPPLNDIEFKYKFKHL |
Gene ID | |
Swiss Prot | |
Synonyms | CP7A; CYP7; CYPVII |
Calculated MW | 58kDa |
Observed MW | 58kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | Mouse liver, Rat liver |
Cellular location | Endoplasmic reticulum membrane, Microsome membrane, Peripheral membrane protein |
Customer validation | WB(Mus musculus, Rattus norvegicus, Actinopterygii, Homo sapiens, Mus musculus) IHC(Bubalus bubalis) IF(Homo sapiens, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A10615? Please let us know so that we can cite the reference in this datasheet.