Review (1)Publications (10) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Immunohistochemistry analysis of paraffin-embedded Mouse heart using Cardiac troponin T (TNNT2) Rabbit mAb (A4914) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Immunofluorescence analysis of paraffin-embedded mouse heart using Cardiac troponin T (TNNT2) Rabbit mAb (A4914) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of paraffin-embedded rat heart using Cardiac troponin T (TNNT2) Rabbit mAb (A4914) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Product name | Cardiac troponin T (TNNT2) Rabbit mAb |
|---|---|
| Catalog No. | A4914 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC1242 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 199-298 of human Cardiac troponin T (TNNT2) (P45379). |
|---|---|
| Sequence | QKQAQTERKSGKRQTEREKKKKILAERRKVLAIDHLNEDQLREKAKELWQSIYNLEAEKFDLQEKFKQQKYEINVLRNRINDNQKVSKTRGKAKVTGRWK |
| Gene ID | |
| Swiss Prot | |
| Synonyms | CMH2; RCM3; TnTC; cTnT; CMD1D; CMPD2; LVNC6; Cardiac troponin T (TNNT2) |
| Calculated MW | 36kDa |
| Observed MW | 36kDa |
| Reactivity | Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Immunohistochemistry Immunofluorescence |
| Positive samples | Mouse skeletal muscle |
| Cellular location | cardiac myofibril, cytosol, sarcomere, striated muscle thin filament. |
| Customer validation | (heart frozen sections) WB(Mus musculus, Homo sapiens) IF(Mus musculus, Homo sapiens) FC(Mus musculus) IHC(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A4914? Please let us know so that we can cite the reference in this datasheet.
