Review (1)Publications (11) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | Cardiac troponin T (TNNT2) Rabbit mAb |
---|---|
Catalog No. | A4914 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC1242 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 199-298 of human Cardiac troponin T (TNNT2) (P45379). |
---|---|
Sequence | QKQAQTERKSGKRQTEREKKKKILAERRKVLAIDHLNEDQLREKAKELWQSIYNLEAEKFDLQEKFKQQKYEINVLRNRINDNQKVSKTRGKAKVTGRWK |
Gene ID | |
Swiss Prot | |
Synonyms | CMH2; RCM3; TnTC; cTnT; CMD1D; CMPD2; LVNC6; Cardiac troponin T (TNNT2) |
Calculated MW | 36kDa |
Observed MW | 36kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Immunohistochemistry Immunofluorescence |
Positive samples | Mouse skeletal muscle |
Cellular location | cardiac myofibril, cytosol, sarcomere, striated muscle thin filament. |
Customer validation | (heart frozen sections) WB(Mus musculus, Homo sapiens) IF(Mus musculus, Homo sapiens) FC(Mus musculus) IHC(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A4914? Please let us know so that we can cite the reference in this datasheet.