제품 > 항체 > 다중클론항체(pAb)

Cardiac troponin T (TNNT2) Rabbit pAb (A1126)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of extracts of various cell lines, using Cardiac troponin T (TNNT2) antibody (A1126) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - Cardiac troponin T (TNNT2) Rabbit pAb (A1126)

Immunofluorescence analysis of rat heart cells using Cardiac troponin T (TNNT2) Rabbit pAb (A1126) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of mouse heart cells using Cardiac troponin T (TNNT2) Rabbit pAb (A1126) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	Cardiac troponin T (TNNT2) Rabbit pAb
Catalog No.	A1126
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes the cardiac isoform of troponin T. The encoded protein is the tropomyosin-binding subunit of the troponin complex, which is located on the thin filament of striated muscles and regulates muscle contraction in response to alterations in intracellular calcium ion concentration. Mutations in this gene have been associated with familial hypertrophic cardiomyopathy as well as with dilated cardiomyopathy.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human Cardiac troponin T (Cardiac troponin T (TNNT2)) (NP_001001431.1).
Sequence	MSDIEEVVEEYEEEEQEEAAVEEQEEAAEEDAEAEAETEETRAEEDEEEEEAKEAEDGPMEESKPKPRSFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHFENRKKEEEEL
Gene ID
Swiss Prot
Synonyms	CMH2; RCM3; TnTC; cTnT; CMD1D; CMPD2; LVNC6
Calculated MW	36kDa
Observed MW	42kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IHC-P 1:100 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Mouse heart, Rat heart
Cellular location	cardiac myofibril, cytosol, sarcomere, striated muscle thin filament
Customer validation	WB(Gallus gallus, Mus musculus, Other) IHC(Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Cardiac troponin T (TNNT2) Rabbit pAb images

Western blot - Cardiac troponin T (TNNT2) Rabbit pAb (A1126)

Immunofluorescence - Cardiac troponin T (TNNT2) Rabbit pAb (A1126)

Immunofluorescence analysis of rat heart cells using Cardiac troponin T (TNNT2) Rabbit pAb (A1126) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence - Cardiac troponin T (TNNT2) Rabbit pAb (A1126)

Immunofluorescence analysis of mouse heart cells using Cardiac troponin T (TNNT2) Rabbit pAb (A1126) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.