제품 > 항체 > 단일클론항체(mAb)

Casein Kinase 2 beta (CSNK2B) Rabbit mAb (A4519)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Casein Kinase 2 beta (CSNK2B) (CSNK2B) Rabbit mAb (A4519) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunofluorescence - Casein Kinase 2 beta (CSNK2B) Rabbit mAb (A4519)

Immunofluorescence analysis of NIH-3T3 cells using Casein Kinase 2 beta (CSNK2B) (CSNK2B) Rabbit mAb (A4519) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U-2 OS cells using Casein Kinase 2 beta (CSNK2B) (CSNK2B) Rabbit mAb (A4519) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	Casein Kinase 2 beta (CSNK2B) Rabbit mAb
Catalog No.	A4519
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1069

Background

This gene encodes the beta subunit of casein kinase II, a ubiquitous protein kinase which regulates metabolic pathways, signal transduction, transcription, translation, and replication. The enzyme is composed of three subunits, alpha, alpha prime and beta, which form a tetrameric holoenzyme. The alpha and alpha prime subunits are catalytic, while the beta subunit serves regulatory functions. The enzyme localizes to the endoplasmic reticulum and the Golgi apparatus. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 101-215 of human Casein Kinase 2 beta (CSNK2B) (CSNK2B) (P67870).
Sequence	YQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
Gene ID
Swiss Prot
Synonyms	G5A; CK2B; CK2N; Ckb1; Ckb2; CSK2B; POBINDS; Casein Kinase 2 beta (CSNK2B)
Calculated MW	25kDa
Observed MW	25kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, K-562, U-251MG, Mouse testis, Mouse spleen, Mouse kidney, Rat testis
Cellular location	cytoplasm, cytosol, extracellular exosome, extracellular region, nucleoplasm, nucleus