Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Caspase-12 Rabbit pAb |
---|---|
Catalog No. | A0217 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Caspase-12 (NP_001177945.2). |
---|---|
Sequence | FNNRNCQSLKDKPKVIIMQACRGNGAGIVWFTTDSGKASADTHGRLLQGNICNDAVTKAHVEKDFIAFKSSTPHNVSWRHETNGSVFISQIIYYFREYSWS |
Gene ID | |
Swiss Prot | |
Synonyms | CASP-12; CASP12P1; Caspase-12 |
Calculated MW | 39kDa |
Observed MW | 55kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | Mouse liver |
Cellular location | AIM2 inflammasome complex, cytoplasm, endoplasmic reticulum, IPAF inflammasome complex, NLRP3 inflammasome complex. |
Customer validation | WB(Sus scrofa, Homo sapiens, Mus musculus, Rattus norvegicus, Canis lupus familiaris) IHC(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A0217? Please let us know so that we can cite the reference in this datasheet.